PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00013.1.g09230.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family SBP
Protein Properties Length: 584aa    MW: 62915.2 Da    PI: 7.0103
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00013.1.g09230.1.sm.mkhcgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.52.9e-41153230178
                                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                                     +CqvegC adl+ ak+yhrrhkvCe+h+ka++++v ++ qrfCqqCsrfh l+efDe+krsCrrrLa+hn+rrrk+q+
  Zjn_sc00013.1.g09230.1.sm.mkhc 153 ACQVEGCVADLTAAKDYHRRHKVCEMHAKASTAVVGKTVQRFCQQCSRFHLLEEFDEGKRSCRRRLAGHNRRRRKTQP 230
                                     5**************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.3E-33148215IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.223151228IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.14E-38152232IPR004333Transcription factor, SBP-box
PfamPF031101.5E-29154227IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 584 aa     Download sequence    Send to blast
MEAARLGAQS SQLYGGGLGE LDLNMREKRV FSWDLNDWSW DSEHFVATPV PASVTNGLEL  60
NSSPSSSEKA EAEVARNGAM RGDSDKRKRV VVIDECEAED QDLIENSGGG GALSLKIGSD  120
AVSPRTLESS GVNEEVRNGK KIKAQGGISS GPACQVEGCV ADLTAAKDYH RRHKVCEMHA  180
KASTAVVGKT VQRFCQQCSR FHLLEEFDEG KRSCRRRLAG HNRRRRKTQP DISFGGAASI  240
EDKVSNYLLL SLLGICANLI SGGTENSNGQ ELLSNLLKNL GSVAKSLELK ELSKLLEACQ  300
SLQNGSNAGT SGTANALANN SAAEAAGPSN SNLLFMNGSQ CGQASSSAIP VQQKATMVAN  360
PGQIMLDKRL APSSFHYCKI LSEDTAAITD DAELDDRETE CLSFCCPAPG SRGRGFIEVE  420
DSGFSNSFFP FIIAEQDVGI SAWKNARDNT GFTPEDYARQ RCNDAYLNLV QKKIDKHISE  480
GHVVVGVPSS MCPVITDFVK PGKVSLEIGR SVSMAAPVAK CHLCRNQALK YQSAAVRTFL  540
YRPAMLTMMG VAVVCVCVGI LLHTMPRVYA APTFRWELLE RGAM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-30147227484squamosa promoter binding protein-like 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002466159.11e-174hypothetical protein SORBIDRAFT_01g002530
SwissprotQ75LH61e-156SPL6_ORYSJ; Squamosa promoter-binding-like protein 6
TrEMBLC5WU181e-174C5WU18_SORBI; Putative uncharacterized protein Sb01g002530
STRINGSb01g002530.11e-174(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19983892
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60030.12e-48squamosa promoter-binding protein-like 12